PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01829.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NAC
Protein Properties Length: 145aa    MW: 17229.2 Da    PI: 10.4447
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01829.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.57.1e-46121372128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                    p G+rFhPtdeelv ++L+ k+++++l+l   i+ev+++++ePwdLp  +k+k++++ wyfF++rd kya ++r+nr+t++g+Wk tgk ++v++ 
  Jcr4S01829.30  12 PIGYRFHPTDEELVAHFLNLKISDHNLDL--PIAEVKVCDFEPWDLPgqSKIKSDDRVWYFFCPRDLKYAYSRRSNRTTEAGFWKPTGKLRKVKK- 104
                    79************************998..7**************96449999999*************************************9. PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    k+ ++g+k++Lvfyk+++pk+++t+W+mhey+l
  Jcr4S01829.30 105 KKMVIGTKRSLVFYKKEHPKPVRTKWIMHEYEL 137
                    9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-473140IPR003441NAC domain
PROSITE profilePS5100543.47111145IPR003441NAC domain
PfamPF023651.5E-2612137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MTSTVRPKMS KPIGYRFHPT DEELVAHFLN LKISDHNLDL PIAEVKVCDF EPWDLPGQSK  60
IKSDDRVWYF FCPRDLKYAY SRRSNRTTEA GFWKPTGKLR KVKKKKMVIG TKRSLVFYKK  120
EHPKPVRTKW IMHEYELPIQ VTLAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-36813712140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7753511e-147KC775351.1 Jatropha curcas NAC transcription factor 073 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083074.11e-101PREDICTED: protein ATAF2-like
RefseqXP_012083075.11e-101PREDICTED: protein ATAF2-like
SwissprotB5X5701e-48NAC14_ARATH; NAC domain-containing protein 14
TrEMBLR4NG023e-95R4NG02_JATCU; NAC transcription factor 073
STRINGAT1G33060.23e-46(Arabidopsis thaliana)
STRINGBra010193.1-P3e-46(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.11e-38NAC 014